Lineage for d1e7ea2 (1e7e A:197-388)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648331Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 648332Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 648333Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 648334Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 648335Species Human (Homo sapiens) [TaxId:9606] [48555] (46 PDB entries)
  8. 648414Domain d1e7ea2: 1e7e A:197-388 [19373]

Details for d1e7ea2

PDB Entry: 1e7e (more details), 2.5 Å

PDB Description: human serum albumin complexed with decanoic acid (capric acid)
PDB Compounds: (A:) serum albumin

SCOP Domain Sequences for d1e7ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7ea2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOP Domain Coordinates for d1e7ea2:

Click to download the PDB-style file with coordinates for d1e7ea2.
(The format of our PDB-style files is described here.)

Timeline for d1e7ea2: