SCOPe 2.06: Domain d2x9cb_: 2x9c B:

Lineage for d2x9cb_ (2x9c B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.20: MxiH-like [140129] (2 families)
   Type III secretion system needle

5. Family a.2.20.0: automated matches [193724] (1 protein)
   not a true family

6. Protein automated matches [193725] (1 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:216597] [193726] (1 PDB entry)

8. Domain d2x9cb_: 2x9c B: [193727]
   automated match to d2ca5b_
   mutant

Details for d2x9cb_

PDB Entry: 2x9c, 2.45 Å

PDB Description: crystal structure of a soluble prgi mutant from salmonella typhimurium

PDB Compounds: (B:) Protein prgI

SCOPe Domain Sequences for d2x9cb_:

Sequence; same for both SEQRES and ATOM records:

>d2x9cb_ a.2.20.0 (B:) automated matches {Salmonella typhimurium [TaxId: 216597]}
tgvdnlqtqvtealdklaakpsdpallaayqsklseynlyrnaqsntakafkdidaaiiq
nfr

Timeline for d2x9cb_:

• d2x9cb_ first appeared in SCOPe 2.02
  
• d2x9cb_ appears in SCOPe 2.05
  
• d2x9cb_ appears in SCOPe 2.07
  
• d2x9cb_ appears in the current release, SCOPe 2.08