Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.20: MxiH-like [140129] (2 families) Type III secretion system needle |
Family a.2.20.0: automated matches [193724] (1 protein) not a true family |
Protein automated matches [193725] (1 species) not a true protein |
Species Salmonella typhimurium [TaxId:216597] [193726] (1 PDB entry) |
Domain d2x9cb_: 2x9c B: [193727] automated match to d2ca5b_ mutant |
PDB Entry: 2x9c (more details), 2.45 Å
SCOPe Domain Sequences for d2x9cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x9cb_ a.2.20.0 (B:) automated matches {Salmonella typhimurium [TaxId: 216597]} tgvdnlqtqvtealdklaakpsdpallaayqsklseynlyrnaqsntakafkdidaaiiq nfr
Timeline for d2x9cb_: