Lineage for d3mcwb_ (3mcw B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864227Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2864228Protein automated matches [190499] (26 species)
    not a true protein
  7. 2864269Species Chromobacterium violaceum [TaxId:243365] [193722] (1 PDB entry)
  8. 2864271Domain d3mcwb_: 3mcw B: [193723]
    automated match to d3lqya_
    complexed with edo, iod

Details for d3mcwb_

PDB Entry: 3mcw (more details), 1.06 Å

PDB Description: crystal structure of an a putative hydrolase of the isochorismatase family (cv_1320) from chromobacterium violaceum atcc 12472 at 1.06 a resolution
PDB Compounds: (B:) Putative hydrolase

SCOPe Domain Sequences for d3mcwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mcwb_ c.33.1.0 (B:) automated matches {Chromobacterium violaceum [TaxId: 243365]}
mpaplrfssdkpllllidmqqavddpswgprnhpqaeqacagllqawrarglplihirhd
svepnstyrpgqpghafkpeveprpgetviakqtnsafigtgleallrangwlelvvagv
stsnsveatvrmagnlgfavclaedgcftfdktdwhgrrrsadevhamslanldgeycrv
cgsadilaalgni

SCOPe Domain Coordinates for d3mcwb_:

Click to download the PDB-style file with coordinates for d3mcwb_.
(The format of our PDB-style files is described here.)

Timeline for d3mcwb_: