Lineage for d3ognb_ (3ogn B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711930Family a.39.2.0: automated matches [191595] (1 protein)
    not a true family
  6. 2711931Protein automated matches [191085] (10 species)
    not a true protein
  7. 2711964Species Culex quinquefasciatus [TaxId:7176] [193717] (2 PDB entries)
  8. 2711966Domain d3ognb_: 3ogn B: [193718]
    automated match to d3k1ea_
    complexed with 3og, mg

Details for d3ognb_

PDB Entry: 3ogn (more details), 1.3 Å

PDB Description: Crystal Structure of an Odorant-binding Protein from the Southern House Mosquito Complexed with an Oviposition Pheromone
PDB Compounds: (B:) odorant-binding protein

SCOPe Domain Sequences for d3ognb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ognb_ a.39.2.0 (B:) automated matches {Culex quinquefasciatus [TaxId: 7176]}
vtprrdaeypppellealkplhdicakktgvtdeaiiefsdgkihedeklkcymnclfhe
akvvddngdvhleklhdslpnsmhdiamhmgkrclypegenlcekafwlhkcwkqadpkh
yflv

SCOPe Domain Coordinates for d3ognb_:

Click to download the PDB-style file with coordinates for d3ognb_.
(The format of our PDB-style files is described here.)

Timeline for d3ognb_: