Lineage for d3qqrb_ (3qqr B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688754Species Parasponia andersonii [TaxId:3476] [193708] (1 PDB entry)
  8. 2688756Domain d3qqrb_: 3qqr B: [193709]
    automated match to d2oifa_
    complexed with dio, hem

Details for d3qqrb_

PDB Entry: 3qqr (more details), 2.16 Å

PDB Description: Crystal structure of Parasponia hemoglobin; Differential Heme Coordination is Linked to Quaternary Structure
PDB Compounds: (B:) Non-legume hemoglobin

SCOPe Domain Sequences for d3qqrb_:

Sequence, based on SEQRES records: (download)

>d3qqrb_ a.1.1.2 (B:) automated matches {Parasponia andersonii [TaxId: 3476]}
vfteeqealvvkawavmkknsaelglqfflkifeiapsaknlfsylkdspvpleqnpklk
phattvfvmtcesavqlrkagkvtvkesdlkrigaihfktgvvnehfevtrfalletike
avpemwspemknawgvaydqlvaaikfemkp

Sequence, based on observed residues (ATOM records): (download)

>d3qqrb_ a.1.1.2 (B:) automated matches {Parasponia andersonii [TaxId: 3476]}
vfteeqealvvkawavmkknsaelglqfflkifeiapsaknlfsylksvleqnpklkpha
ttvfvmtcesavqlrkagkvtvkesdlkrigaihfktgvvnehfevtrfalletikeavp
emwspemknawgvaydqlvaaikfemkp

SCOPe Domain Coordinates for d3qqrb_:

Click to download the PDB-style file with coordinates for d3qqrb_.
(The format of our PDB-style files is described here.)

Timeline for d3qqrb_: