Lineage for d3rkja_ (3rkj A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224490Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1224491Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1224808Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1224809Protein automated matches [190418] (5 species)
    not a true protein
  7. 1224814Species Klebsiella pneumoniae [TaxId:573] [189718] (11 PDB entries)
  8. 1224820Domain d3rkja_: 3rkj A: [193705]
    automated match to d3srxa_
    complexed with gol, so4

Details for d3rkja_

PDB Entry: 3rkj (more details), 2 Å

PDB Description: Crystal Structure of New Delhi Metallo-Beta-Lactamase-1 from Klebsiella pnueumoniae
PDB Compounds: (A:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d3rkja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rkja_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
rfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnw
ikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfa
angwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgda
dtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d3rkja_:

Click to download the PDB-style file with coordinates for d3rkja_.
(The format of our PDB-style files is described here.)

Timeline for d3rkja_: