Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (5 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [189718] (11 PDB entries) |
Domain d3rkja_: 3rkj A: [193705] automated match to d3srxa_ complexed with gol, so4 |
PDB Entry: 3rkj (more details), 2 Å
SCOPe Domain Sequences for d3rkja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rkja_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]} rfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnw ikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfa angwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgda dtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
Timeline for d3rkja_: