Lineage for d3q27a_ (3q27 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (30 species)
    not a true protein
  7. 2145262Species Escherichia coli [TaxId:562] [189978] (9 PDB entries)
  8. 2145263Domain d3q27a_: 3q27 A: [193704]
    automated match to d3q25a_
    complexed with gol, mal, so4

Details for d3q27a_

PDB Entry: 3q27 (more details), 1.3 Å

PDB Description: cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (mbp)
PDB Compounds: (A:) Maltose-binding periplasmic protein/alpha-synuclein chimeric protein

SCOPe Domain Sequences for d3q27a_:

Sequence, based on SEQRES records: (download)

>d3q27a_ c.94.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
mkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
ifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynk
dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydik
dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsk
vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvde
alkdaqtnsssktkegvlyvgsktkegvvhgvatva

Sequence, based on observed residues (ATOM records): (download)

>d3q27a_ c.94.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
mkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
ifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynk
dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydik
dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsk
vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvde
alkdaqtnssvlyvgsktkegvvhgvatva

SCOPe Domain Coordinates for d3q27a_:

Click to download the PDB-style file with coordinates for d3q27a_.
(The format of our PDB-style files is described here.)

Timeline for d3q27a_: