Lineage for d3ak4d_ (3ak4 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454270Species Agrobacterium tumefaciens [TaxId:358] [193697] (5 PDB entries)
  8. 2454274Domain d3ak4d_: 3ak4 D: [193698]
    automated match to d1gega_
    complexed with nad

Details for d3ak4d_

PDB Entry: 3ak4 (more details), 2 Å

PDB Description: Crystal structure of NADH-dependent quinuclidinone reductase from agrobacterium tumefaciens
PDB Compounds: (D:) NADH-dependent quinuclidinone reductase

SCOPe Domain Sequences for d3ak4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ak4d_ c.2.1.0 (D:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
gifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglenggfavev
dvtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnargvflan
qiacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapknirvn
cvcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvflasda
arfmtgqginvtggvrmd

SCOPe Domain Coordinates for d3ak4d_:

Click to download the PDB-style file with coordinates for d3ak4d_.
(The format of our PDB-style files is described here.)

Timeline for d3ak4d_: