Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
Protein Viral RNA polymerase [56695] (17 species) |
Species Foot-and-mouth disease virus - type c [TaxId:12116] [187085] (9 PDB entries) |
Domain d3nl0a1: 3nl0 A:1-470 [193696] Other proteins in same PDB: d3nl0a2 automated match to d1u09a_ protein/RNA complex; complexed with mg; mutant missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 3nl0 (more details), 2.6 Å
SCOPe Domain Sequences for d3nl0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nl0a1 e.8.1.4 (A:1-470) Viral RNA polymerase {Foot-and-mouth disease virus - type c [TaxId: 12116]} glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdsrlnegvvldevifskh kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggipsgc satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda
Timeline for d3nl0a1: