Lineage for d1bj5_1 (1bj5 3-196)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543789Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 543790Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 543791Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 543792Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 543793Species Human (Homo sapiens) [TaxId:9606] [48555] (26 PDB entries)
  8. 543839Domain d1bj5_1: 1bj5 3-196 [19369]

Details for d1bj5_1

PDB Entry: 1bj5 (more details), 2.5 Å

PDB Description: human serum albumin complexed with myristic acid

SCOP Domain Sequences for d1bj5_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bj5_1 a.126.1.1 (3-196) Serum albumin {Human (Homo sapiens)}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

SCOP Domain Coordinates for d1bj5_1:

Click to download the PDB-style file with coordinates for d1bj5_1.
(The format of our PDB-style files is described here.)

Timeline for d1bj5_1: