Lineage for d3rpha_ (3rph A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872415Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1872416Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1872553Family c.72.1.4: YjeF C-terminal domain-like [75292] (3 proteins)
    automatically mapped to Pfam PF01256
  6. 1872580Protein automated matches [193682] (1 species)
    not a true protein
  7. 1872581Species Bacillus subtilis [TaxId:1423] [193683] (9 PDB entries)
  8. 1872587Domain d3rpha_: 3rph A: [193684]
    automated match to d1kyha_
    complexed with amp, mg, po4

Details for d3rpha_

PDB Entry: 3rph (more details), 1.75 Å

PDB Description: crystal structure of adp/atp-dependent nad(p)h-hydrate dehydratase from bacillus subtilis co-crystallized with atp/mg2+.
PDB Compounds: (A:) ADP/ATP-dependent NAD(P)H-hydrate dehydratase

SCOPe Domain Sequences for d3rpha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rpha_ c.72.1.4 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
amnvpfwteehvratlperdaeshkgtygtalllagsddmpgaallaglgamrsglgklv
igtsenviplivpvlpeatywrdgwkkaadaqleetyraiaigpglpqtesvqqavdhvl
tadcpvildagalakrtypkregpviltphpgeffrmtgvpvnelqkkraeyakewaaql
qtvivlkgnqtviafpdgdcwlnptgngalakggtgdtltgmilgmlcchedpkhavlna
vylhgacaelwtdehsahtllahelsdilprvwkrfe

SCOPe Domain Coordinates for d3rpha_:

Click to download the PDB-style file with coordinates for d3rpha_.
(The format of our PDB-style files is described here.)

Timeline for d3rpha_: