Lineage for d3zqkb_ (3zqk B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892463Family c.62.1.0: automated matches [191586] (1 protein)
    not a true family
  6. 2892464Protein automated matches [191045] (3 species)
    not a true protein
  7. 2892467Species Human (Homo sapiens) [TaxId:9606] [188880] (10 PDB entries)
  8. 2892469Domain d3zqkb_: 3zqk B: [193678]
    automated match to d3ppya_
    complexed with ca, gol, nag

Details for d3zqkb_

PDB Entry: 3zqk (more details), 1.7 Å

PDB Description: von willebrand factor a2 domain with calcium
PDB Compounds: (B:) von willebrand factor

SCOPe Domain Sequences for d3zqkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zqkb_ c.62.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smvldvafvlegsdkigeadfnrskefmeeviqrmdvgqdsihvtvlqysymvtveypfs
eaqskgdilqrlreiryqggnrtntglalrylsdhsflvsqgdreqapnlvymvtgnpas
deikrlpgdiqvvpigvgpnanvqelerigwpnapiliqdfetlpreapdlvlqrccs

SCOPe Domain Coordinates for d3zqkb_:

Click to download the PDB-style file with coordinates for d3zqkb_.
(The format of our PDB-style files is described here.)

Timeline for d3zqkb_: