Lineage for d3asou_ (3aso U:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1090060Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 1090061Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 1090062Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 1090079Protein automated matches [190271] (1 species)
    not a true protein
  7. 1090080Species Cow (Bos taurus) [TaxId:9913] [187063] (17 PDB entries)
  8. 1090103Domain d3asou_: 3aso U: [193677]
    Other proteins in same PDB: d3asoc_, d3asof_, d3asog_, d3ason_, d3asop_, d3asoq_, d3asor_, d3asos_, d3asot_, d3asov_, d3asow_, d3asox_, d3asoy_, d3asoz_
    automated match to d1v54h_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asou_

PDB Entry: 3aso (more details), 2.3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d3asou_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asou_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d3asou_:

Click to download the PDB-style file with coordinates for d3asou_.
(The format of our PDB-style files is described here.)

Timeline for d3asou_: