SCOPe 2.06: Domain d3sozc_: 3soz C:

Lineage for d3sozc_ (3soz C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.9: STM3548-like [159492] (2 proteins)
   Pfam PF07090; DUF1355

6. Protein automated matches [193670] (1 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [193671] (1 PDB entry)

8. Domain d3sozc_: 3soz C: [193672]
   automated match to d2gk3e_
   complexed with gol

Details for d3sozc_

PDB Entry: 3soz, 2.6 Å

PDB Description: Cytoplasmic Protein STM1381 from Salmonella typhimurium LT2

PDB Compounds: (C:) Cytoplasmic Protein STM1381

SCOPe Domain Sequences for d3sozc_:

Sequence; same for both SEQRES and ATOM records:

>d3sozc_ c.23.16.9 (C:) automated matches {Salmonella enterica [TaxId: 99287]}
mkilfigeswhihmihskgfdsftsskyeegadyllsclrqgnidvdympahivqtrfpq
taealacydaivisdigsntfllqnrtfynmdiipdalqliadyvaegggllmiggylsf
tgieakanykntvlaevlpvdmldvddrvelpqgckavntavehvitqpfsewppllgyn
kliakensqvlaeingdpllvmgtyhkgkvccfasdcsphwgspqflqwehyatfwcnvl
htikk

Timeline for d3sozc_:

• d3sozc_ first appeared in SCOPe 2.02
  
• d3sozc_ appears in SCOPe 2.05
  
• d3sozc_ appears in SCOPe 2.07
  
• d3sozc_ appears in the current release, SCOPe 2.08