Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.9: STM3548-like [159492] (2 proteins) Pfam PF07090; DUF1355 |
Protein automated matches [193670] (1 species) not a true protein |
Species Salmonella enterica [TaxId:99287] [193671] (1 PDB entry) |
Domain d3sozc_: 3soz C: [193672] automated match to d2gk3e_ complexed with gol |
PDB Entry: 3soz (more details), 2.6 Å
SCOPe Domain Sequences for d3sozc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sozc_ c.23.16.9 (C:) automated matches {Salmonella enterica [TaxId: 99287]} mkilfigeswhihmihskgfdsftsskyeegadyllsclrqgnidvdympahivqtrfpq taealacydaivisdigsntfllqnrtfynmdiipdalqliadyvaegggllmiggylsf tgieakanykntvlaevlpvdmldvddrvelpqgckavntavehvitqpfsewppllgyn kliakensqvlaeingdpllvmgtyhkgkvccfasdcsphwgspqflqwehyatfwcnvl htikk
Timeline for d3sozc_: