Class b: All beta proteins [48724] (174 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.7: Satellite viruses [88650] (1 family) |
Family b.121.7.1: Satellite viruses [88651] (3 proteins) |
Protein automated matches [193665] (1 species) not a true protein |
Species Tobacco necrosis satellite virus 1 [TaxId:12445] [193666] (1 PDB entry) |
Domain d1vtzk_: 1vtz k: [193669] automated match to d3rqva_ complexed with ca |
PDB Entry: 1vtz (more details), 1.45 Å
SCOPe Domain Sequences for d1vtzk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vtzk_ b.121.7.1 (k:) automated matches {Tobacco necrosis satellite virus 1 [TaxId: 12445]} tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav ytda
Timeline for d1vtzk_: