SCOPe 2.08: Domain d1vtz5_: 1vtz 5:

Lineage for d1vtz5_ (1vtz 5:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.7: Satellite viruses [88650] (1 family)

5. Family b.121.7.1: Satellite viruses [88651] (3 proteins)

6. Protein automated matches [193665] (1 species)
   not a true protein

7. Species Tobacco necrosis satellite virus 1 [TaxId:12445] [193666] (1 PDB entry)

8. Domain d1vtz5_: 1vtz 5: [193667]
   Other proteins in same PDB: d1vtz0_, d1vtz1_, d1vtz2_, d1vtz3_, d1vtz4_, d1vtz6_, d1vtze_, d1vtzf_, d1vtzg_, d1vtzh_, d1vtzi_, d1vtzj_, d1vtzl_, d1vtzm_, d1vtzn_, d1vtzo_, d1vtzp_, d1vtzq_, d1vtzr_, d1vtzs_, d1vtzt_, d1vtzu_, d1vtzv_, d1vtzw_, d1vtzx_, d1vtzy_, d1vtzz_
   complexed with ca
   complexed with ca

Details for d1vtz5_

PDB Entry: 1vtz, 1.45 Å

PDB Description: 1.45 Angstrom Structure of STNV coat protein (half of the capsid, the other half in PDB 3RQV)

PDB Compounds: (5:) coat protein

SCOPe Domain Sequences for d1vtz5_:

Sequence; same for both SEQRES and ATOM records:

>d1vtz5_ b.121.7.1 (5:) automated matches {Tobacco necrosis satellite virus 1 [TaxId: 12445]}
tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
ytda

Timeline for d1vtz5_:

• d1vtz5_ first appeared in SCOPe 2.02
  
• d1vtz5_ appears in SCOPe 2.07