SCOPe 2.06: Domain d3salb_: 3sal B:

Lineage for d3salb_ (3sal B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.0: automated matches [191452] (1 protein)
   not a true family

6. Protein automated matches [190692] (15 species)
   not a true protein

7. Species Influenza A virus [TaxId:385582] [189809] (3 PDB entries)

8. Domain d3salb_: 3sal B: [193662]
   automated match to d3ti8a_
   complexed with ca, gol

Details for d3salb_

PDB Entry: 3sal, 1.5 Å

PDB Description: crystal structure of influenza a virus neuraminidase n5

PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d3salb_:

Sequence; same for both SEQRES and ATOM records:

>d3salb_ b.68.1.0 (B:) automated matches {Influenza A virus [TaxId: 385582]}
peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
iwtsssstvfcgvssevpgwswddgailpfdidk

Timeline for d3salb_:

• d3salb_ first appeared in SCOPe 2.02
  
• d3salb_ appears in SCOPe 2.05
  
• d3salb_ appears in SCOPe 2.07
  
• d3salb_ appears in the current release, SCOPe 2.08