![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.1: Sialidases [50939] (3 families) ![]() |
![]() | Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
![]() | Protein automated matches [190692] (11 species) not a true protein |
![]() | Species Influenza A virus [TaxId:385582] [189809] (3 PDB entries) |
![]() | Domain d3salb_: 3sal B: [193662] automated match to d3ti8a_ complexed with ca, gol |
PDB Entry: 3sal (more details), 1.5 Å
SCOPe Domain Sequences for d3salb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3salb_ b.68.1.0 (B:) automated matches {Influenza A virus [TaxId: 385582]} peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts iwtsssstvfcgvssevpgwswddgailpfdidk
Timeline for d3salb_: