SCOP 1.65: Domain d1e7ha1: 1e7h A:3-196

Lineage for d1e7ha1 (1e7h A:3-196)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulphide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (25 PDB entries)

8. Domain d1e7ha1: 1e7h A:3-196 [19366]

Details for d1e7ha1

PDB Entry: 1e7h, 2.43 Å

PDB Description: human serum albumin complexed with hexadecanoic acid (palmitic acid)

SCOP Domain Sequences for d1e7ha1:

Sequence; same for both SEQRES and ATOM records:

>d1e7ha1 a.126.1.1 (A:3-196) Serum albumin {Human (Homo sapiens)}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

Timeline for d1e7ha1:

• d1e7ha1 first appeared (with stable ids) in SCOP 1.55
  
• d1e7ha1 appears in SCOP 1.63
  
• d1e7ha1 appears in SCOP 1.67
  
• d1e7ha1 appears in the current release, SCOPe 2.08