Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (28 species) not a true protein |
Species Thermoplasma acidophilum [TaxId:273075] [189712] (12 PDB entries) |
Domain d3s1ue_: 3s1u E: [193657] automated match to d3s0cd_ complexed with cl, e4p |
PDB Entry: 3s1u (more details), 1.9 Å
SCOPe Domain Sequences for d3s1ue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s1ue_ c.1.10.1 (E:) automated matches {Thermoplasma acidophilum [TaxId: 273075]} mkifldtanideirtgvnwgivdgvttnptliskeavngkkygdiireilkivdgpvsve vvstkyegmveearkihglgdnavvkipmtedglraiktlssehintnctlvfnpiqall aakagvtyvspfvgrlddigedgmqiidmirtifnnyiiktqilvasirnpihvlrsavi gadvvtvpfnvlkslmkhpktdeglakfledwkkvspd
Timeline for d3s1ue_:
View in 3D Domains from other chains: (mouse over for more information) d3s1ua_, d3s1ub_, d3s1uc_, d3s1ud_ |