![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
![]() | Protein automated matches [190370] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries) |
![]() | Domain d3siea_: 3sie A: [193656] automated match to d3b2ra_ complexed with 5bo |
PDB Entry: 3sie (more details), 1.93 Å
SCOPe Domain Sequences for d3siea_:
Sequence, based on SEQRES records: (download)
>d3siea_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} relqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlcr wilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdldh rgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlkiik qailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqr iaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthvse dcfplldgcrknrqkwqalaeqq
>d3siea_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} relqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlcr wilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdldh imehhhfdqclmilnspgnqilsglsieeykttlkiikqailatdlalyikrrgeffeli rknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelvateffdqgdrerkeptd lmnrekknkipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqq
Timeline for d3siea_: