Lineage for d3olxb_ (3olx B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1837704Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1837715Protein CheY protein [52174] (5 species)
  7. 1837716Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
    Uniprot P06143
  8. 1837750Domain d3olxb_: 3olx B: [193654]
    automated match to d1djma_
    complexed with bef, gol, mg, mn, so4

Details for d3olxb_

PDB Entry: 3olx (more details), 2.1 Å

PDB Description: structural and functional effects of substitution at position t+1 in chey: cheya88s-bef3-mn complex
PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3olxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3olxb_ c.23.1.1 (B:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtseakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d3olxb_:

Click to download the PDB-style file with coordinates for d3olxb_.
(The format of our PDB-style files is described here.)

Timeline for d3olxb_: