SCOPe 2.08: Domain d3rofa1: 3rof A:1-152

Lineage for d3rofa1 (3rof A:1-152)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (20 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [193646] (1 PDB entry)

8. Domain d3rofa1: 3rof A:1-152 [193647]
   Other proteins in same PDB: d3rofa2, d3rofa3
   automated match to d2cwdc_
   complexed with po4

Details for d3rofa1

PDB Entry: 3rof, 1.03 Å

PDB Description: crystal structure of the s. aureus protein tyrosine phosphatase ptpa

PDB Compounds: (A:) Low molecular weight protein-tyrosine-phosphatase ptpA

SCOPe Domain Sequences for d3rofa1:

Sequence; same for both SEQRES and ATOM records:

>d3rofa1 c.44.1.0 (A:1-152) automated matches {Staphylococcus aureus [TaxId: 1280]}
mvdvafvclgnicrspmaeaimrqrlkdrnihdikvhsrgtgswnlgepphegtqkilnk
hnipfdgmiselfeatddfdyivamdqsnvdniksinpnlkgqlfkllefsnmeesdvpd
pyytnnfegvydmvlsscdnlidyivkdanlk

Timeline for d3rofa1:

• d3rofa1 first appeared in SCOPe 2.02, called d3rofa_
  
• d3rofa1 appears in SCOPe 2.07