| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) ![]() share the common active site structure with the family II |
| Family c.44.1.0: automated matches [191415] (1 protein) not a true family |
| Protein automated matches [190574] (20 species) not a true protein |
| Species Staphylococcus aureus [TaxId:1280] [193646] (1 PDB entry) |
| Domain d3rofa1: 3rof A:1-152 [193647] Other proteins in same PDB: d3rofa2, d3rofa3 automated match to d2cwdc_ complexed with po4 |
PDB Entry: 3rof (more details), 1.03 Å
SCOPe Domain Sequences for d3rofa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rofa1 c.44.1.0 (A:1-152) automated matches {Staphylococcus aureus [TaxId: 1280]}
mvdvafvclgnicrspmaeaimrqrlkdrnihdikvhsrgtgswnlgepphegtqkilnk
hnipfdgmiselfeatddfdyivamdqsnvdniksinpnlkgqlfkllefsnmeesdvpd
pyytnnfegvydmvlsscdnlidyivkdanlk
Timeline for d3rofa1: