| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein automated matches [193445] (1 species) not a true protein |
| Species Homo sapiens [TaxId:9606] [193446] (12 PDB entries) |
| Domain d3azja_: 3azj A: [193636] automated match to d1kx5a_ protein/DNA complex; complexed with cl, mn; mutant |
PDB Entry: 3azj (more details), 2.89 Å
SCOPe Domain Sequences for d3azja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3azja_ a.22.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
aylvglfedtnlcaihakrvtimpkdiqlarrirger
Timeline for d3azja_: