Lineage for d3azja_ (3azj A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1083052Protein automated matches [193445] (1 species)
    not a true protein
  7. 1083053Species Homo sapiens [TaxId:9606] [193446] (12 PDB entries)
  8. 1083064Domain d3azja_: 3azj A: [193636]
    automated match to d1kx5a_
    protein/DNA complex; complexed with cl, mn; mutant

Details for d3azja_

PDB Entry: 3azj (more details), 2.89 Å

PDB Description: Crystal Structure of Human Nucleosome Core Particle Containing H4K44Q mutation
PDB Compounds: (A:) Histone H3.1

SCOPe Domain Sequences for d3azja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3azja_ a.22.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
aylvglfedtnlcaihakrvtimpkdiqlarrirger

SCOPe Domain Coordinates for d3azja_:

Click to download the PDB-style file with coordinates for d3azja_.
(The format of our PDB-style files is described here.)

Timeline for d3azja_: