![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.80.1: SIS domain [53697] (4 families) ![]() |
![]() | Family c.80.1.0: automated matches [191405] (1 protein) not a true family |
![]() | Protein automated matches [190547] (18 species) not a true protein |
![]() | Species Francisella tularensis [TaxId:119856] [193630] (1 PDB entry) |
![]() | Domain d3trjd_: 3trj D: [193631] automated match to d3bjzd_ |
PDB Entry: 3trj (more details), 2.8 Å
SCOPe Domain Sequences for d3trjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3trjd_ c.80.1.0 (D:) automated matches {Francisella tularensis [TaxId: 119856]} mtsldkinsyfessiqakietanalppaiaqaakamvsclenggkvlvcgngssgviaqh ftskllnhfemerpplpaialtgdvatitavgnhygfsqifakqvaalgneddillvitt sgdsenilsaveeahdlemkvialtggsggalqnmyntddielrvpsdnianiqenhfli vhclcdiidqk
Timeline for d3trjd_: