Lineage for d1e7ab1 (1e7a B:5-196)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101110Fold a.126: Serum albumin-like [48551] (1 superfamily)
  4. 101111Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 101112Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 101113Protein Serum albumin [48554] (1 species)
  7. 101114Species Human (Homo sapiens) [TaxId:9606] [48555] (18 PDB entries)
  8. 101142Domain d1e7ab1: 1e7a B:5-196 [19363]

Details for d1e7ab1

PDB Entry: 1e7a (more details), 2.2 Å

PDB Description: crystal structure of human serum albumin complexed with the general anesthetic propofol

SCOP Domain Sequences for d1e7ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7ab1 a.126.1.1 (B:5-196) Serum albumin {Human (Homo sapiens)}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvmc
tafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpklde
lrdegkassakq

SCOP Domain Coordinates for d1e7ab1:

Click to download the PDB-style file with coordinates for d1e7ab1.
(The format of our PDB-style files is described here.)

Timeline for d1e7ab1: