Lineage for d3teod_ (3teo D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883078Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2883196Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 2883197Protein automated matches [190830] (15 species)
    not a true protein
  7. 2883198Species Acidianus sp. [TaxId:1071056] [193625] (2 PDB entries)
  8. 2883202Domain d3teod_: 3teo D: [193629]
    automated match to d3lasa_
    complexed with cl, pe3

Details for d3teod_

PDB Entry: 3teo (more details), 2.4 Å

PDB Description: apo form of carbon disulfide hydrolase (selenomethionine form)
PDB Compounds: (D:) Carbon disulfide hydrolase

SCOPe Domain Sequences for d3teod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3teod_ c.53.2.0 (D:) automated matches {Acidianus sp. [TaxId: 1071056]}
vseyidselkrledyalrrvkgipnnrrlwvltcmdervhieqslgiqpddahiyrnagg
ivtddairsaslttnffgtkeiivvthtdcgmlrftgeevakyfiskgikptevqldpll
pafrisseedfikwfkfyedlgvkspdemalkgveilrnhplipkdvritgyvyevethr
lrkpnqiiynetskfehgtivk

SCOPe Domain Coordinates for d3teod_:

Click to download the PDB-style file with coordinates for d3teod_.
(The format of our PDB-style files is described here.)

Timeline for d3teod_: