Lineage for d3e5ja_ (3e5j A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278253Species Streptomyces avermitilis [TaxId:33903] [189294] (5 PDB entries)
  8. 1278255Domain d3e5ja_: 3e5j A: [193622]
    automated match to d2z36a_
    complexed with hem

Details for d3e5ja_

PDB Entry: 3e5j (more details), 1.95 Å

PDB Description: Crystal structure of CYP105P1 wild-type ligand-free form
PDB Compounds: (A:) Cytochrome P450 (Cytochrome P450 hydroxylase)

SCOPe Domain Sequences for d3e5ja_:

Sequence, based on SEQRES records: (download)

>d3e5ja_ a.104.1.0 (A:) automated matches {Streptomyces avermitilis [TaxId: 33903]}
daptvpkarscpflppdgiadiraaapvtratftsgheawlvtgyeevrallrdssfsvq
vphalhtqdgvvtqkpgrgsllwqdepehtsdrkllakeftvrrmqalrpniqrivdehl
daiearggpvdlvktfanavpsmvisdlfgvpverraefqdiaeammrvdqdaaateaag
mrlggllyqlvqerranpgddlisalittedpdgvvddmflmnaagtlliaahdttacmi
glgtallldspdqlallredpslvgnaveellryltigqfggervatrdvelggvriakg
eqvvahvlaadfdpafveeperfditrrpaphlafgfgahqcigqqlarielqivfetlf
rrlpglrlakpveelrfrhdivfygvhelpvtwh

Sequence, based on observed residues (ATOM records): (download)

>d3e5ja_ a.104.1.0 (A:) automated matches {Streptomyces avermitilis [TaxId: 33903]}
daptvpkarscpflppdgiadiraaapvtratftsgheawlvtgyeevrallrdssfsvq
vphalhtqdgvvgrgsllwqdepehtsdrkllakeftvrrmqalrpniqrivdehldaie
arggpvdlvktfanavpsmvisdlfgvpverraefqdiaeammrvdqdaaateaagmrlg
gllyqlvqerranpgddlisalittedpdgvvddmflmnaagtlliaahdttacmiglgt
allldspdqlallredpslvgnaveellryltigqfggervatrdvelggvriakgeqvv
ahvlaadfdpafveeperfditrrpaphlafgfgahqcigqqlarielqivfetlfrrlp
glrlakpveelrfrhdivfygvhelpvtwh

SCOPe Domain Coordinates for d3e5ja_:

Click to download the PDB-style file with coordinates for d3e5ja_.
(The format of our PDB-style files is described here.)

Timeline for d3e5ja_: