Lineage for d3b6bf_ (3b6b F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907823Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1907824Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1907825Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 1907826Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [224931] (1 PDB entry)
  8. 1907832Domain d3b6bf_: 3b6b F: [193620]
    automated match to d3gp9a_
    complexed with dgi, mg

Details for d3b6bf_

PDB Entry: 3b6b (more details), 2 Å

PDB Description: Crystal structure of Acanthamoeba polyphaga mimivirus nucleoside diphosphate kinase complexed with dGDP
PDB Compounds: (F:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3b6bf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b6bf_ d.58.6.1 (F:) Nucleoside diphosphate kinase, NDK {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
glqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyf
ndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdseds
avdeisiwfp

SCOPe Domain Coordinates for d3b6bf_:

Click to download the PDB-style file with coordinates for d3b6bf_.
(The format of our PDB-style files is described here.)

Timeline for d3b6bf_: