SCOPe 2.08: Domain d3b6bf1: 3b6b F:2-129

Lineage for d3b6bf1 (3b6b F:2-129)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [224931] (1 PDB entry)

8. Domain d3b6bf1: 3b6b F:2-129 [193620]
   Other proteins in same PDB: d3b6ba2, d3b6bb2, d3b6bc2, d3b6bd2, d3b6be2, d3b6bf2
   automated match to d3gp9a_
   complexed with dgi, mg

Details for d3b6bf1

PDB Entry: 3b6b, 2 Å

PDB Description: Crystal structure of Acanthamoeba polyphaga mimivirus nucleoside diphosphate kinase complexed with dGDP

PDB Compounds: (F:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3b6bf1:

Sequence; same for both SEQRES and ATOM records:

>d3b6bf1 d.58.6.1 (F:2-129) Nucleoside diphosphate kinase, NDK {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfp

Timeline for d3b6bf1:

• d3b6bf1 first appeared in SCOPe 2.02, called d3b6bf_
  
• d3b6bf1 appears in SCOPe 2.07