| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
| Protein automated matches [190501] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187448] (21 PDB entries) |
| Domain d3va2b_: 3va2 B: [193617] automated match to d3qt2c_ |
PDB Entry: 3va2 (more details), 2.7 Å
SCOPe Domain Sequences for d3va2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3va2b_ a.26.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggt
verlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewii
Timeline for d3va2b_: