Lineage for d4b1tb_ (4b1t B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1201702Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 1201703Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 1201704Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
  6. 1201757Protein automated matches [190792] (2 species)
    not a true protein
  7. 1201760Species Hirudo medicinalis [TaxId:6421] [193615] (4 PDB entries)
  8. 1201764Domain d4b1tb_: 4b1t B: [193616]
    Other proteins in same PDB: d4b1ta_, d4b1tc_
    automated match to d1egla_
    complexed with ca, edo, gol

Details for d4b1tb_

PDB Entry: 4b1t (more details), 1.78 Å

PDB Description: structure of the factor xa-like trypsin variant triple-ala (ta) in complex with eglin c
PDB Compounds: (B:) eglin c

SCOPe Domain Sequences for d4b1tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b1tb_ d.40.1.1 (B:) automated matches {Hirudo medicinalis [TaxId: 6421]}
efgselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgtn
vvnhvphvg

SCOPe Domain Coordinates for d4b1tb_:

Click to download the PDB-style file with coordinates for d4b1tb_.
(The format of our PDB-style files is described here.)

Timeline for d4b1tb_: