![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
![]() | Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) ![]() |
![]() | Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
![]() | Protein automated matches [190792] (4 species) not a true protein |
![]() | Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [193615] (5 PDB entries) |
![]() | Domain d4b1tb_: 4b1t B: [193616] Other proteins in same PDB: d4b1ta_, d4b1tc_ automated match to d1egla_ complexed with ca, edo, gol |
PDB Entry: 4b1t (more details), 1.78 Å
SCOPe Domain Sequences for d4b1tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b1tb_ d.40.1.1 (B:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} efgselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgtn vvnhvphvg
Timeline for d4b1tb_: