Lineage for d4ddnb_ (4ddn B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1137196Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 1137214Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 1137330Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 1137331Protein automated matches [190516] (2 species)
    not a true protein
  7. 1137332Species Ipomoea batatas [TaxId:4120] [193613] (1 PDB entry)
  8. 1137333Domain d4ddnb_: 4ddn B: [193614]
    automated match to d1ouwb_
    complexed with amg

Details for d4ddnb_

PDB Entry: 4ddn (more details), 1.9 Å

PDB Description: structure analysis of a wound-inducible lectin ipomoelin from sweet potato
PDB Compounds: (B:) Ipomoelin

SCOPe Domain Sequences for d4ddnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ddnb_ b.77.3.0 (B:) automated matches {Ipomoea batatas [TaxId: 4120]}
malqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitfssnptd
iitvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygpyganag
tpfnikipdgnkivgffgnsgwyvdaigayytak

SCOPe Domain Coordinates for d4ddnb_:

Click to download the PDB-style file with coordinates for d4ddnb_.
(The format of our PDB-style files is described here.)

Timeline for d4ddnb_: