Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.12: Haloperoxidase [53531] (8 proteins) |
Protein automated matches [190860] (3 species) not a true protein |
Species Pseudomonas fluorescens [TaxId:294] [189239] (4 PDB entries) |
Domain d3t52d_: 3t52 D: [193608] automated match to d1va4a_ complexed with act, cl, gol, peo, so4; mutant |
PDB Entry: 3t52 (more details), 2 Å
SCOPe Domain Sequences for d3t52d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t52d_ c.69.1.12 (D:) automated matches {Pseudomonas fluorescens [TaxId: 294]} stfvakdgtqiyfkdwgsgkpvlfshgwildadmweyqmeylssrgyrtiafdrrgfgrs dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg aelkvykdaphgfavthaqqlnedllaflkr
Timeline for d3t52d_: