| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.96.1: DNA-glycosylase [48150] (7 families) ![]() |
| Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins) |
| Protein automated matches [191081] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189020] (3 PDB entries) |
| Domain d4e9ea_: 4e9e A: [193598] automated match to d1ngna_ |
PDB Entry: 4e9e (more details), 1.9 Å
SCOPe Domain Sequences for d4e9ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e9ea_ a.96.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kwtpprspfnlvqetlfhdpwklliatiflnrtsgkmaipvlwkflekypsaevartadw
rdvsellkplglydlraktivkfsdeyltkqwkypielhgigkygndsyrifcvnewkqv
hpedhklnkyhdwlwenhek
Timeline for d4e9ea_: