Lineage for d3tvnx_ (3tvn X:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2401369Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2401370Protein Carbonic anhydrase [51071] (10 species)
  7. 2401409Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (704 PDB entries)
    Uniprot P00918
  8. 2401756Domain d3tvnx_: 3tvn X: [193597]
    automated match to d3oika_
    complexed with zn; mutant

Details for d3tvnx_

PDB Entry: 3tvn (more details), 1.5 Å

PDB Description: human carbonic anhydrase ii proton transfer mutant
PDB Compounds: (X:) Carbonic anhydrase 2

SCOPe Domain Sequences for d3tvnx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tvnx_ b.74.1.1 (X:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafqvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOPe Domain Coordinates for d3tvnx_:

Click to download the PDB-style file with coordinates for d3tvnx_.
(The format of our PDB-style files is described here.)

Timeline for d3tvnx_: