Lineage for d4gfsa_ (4gfs A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2096923Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2097472Protein automated matches [190095] (24 species)
    not a true protein
  7. 2097700Species Salmonella typhimurium [TaxId:90371] [189452] (5 PDB entries)
  8. 2097709Domain d4gfsa_: 4gfs A: [193583]
    automated match to d3oexb_
    complexed with ni, sin

Details for d4gfsa_

PDB Entry: 4gfs (more details), 1.8 Å

PDB Description: 1.8 Angstrom Crystal Structure of the 3-Dehydroquinate Dehydratase (aroD) from Salmonella typhimurium LT2 with Nickel Bound at Active Site
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4gfsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gfsa_ c.1.10.1 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaesv
leaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftgd
devkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkadv
ltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisvad
lrtvltilhqa

SCOPe Domain Coordinates for d4gfsa_:

Click to download the PDB-style file with coordinates for d4gfsa_.
(The format of our PDB-style files is described here.)

Timeline for d4gfsa_: