Lineage for d3s44a_ (3s44 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517892Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2517893Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2518349Family c.87.1.9: Sialyltransferase-like [142773] (2 proteins)
    automatically mapped to Pfam PF11477
  6. 2518366Protein automated matches [190544] (2 species)
    not a true protein
  7. 2518373Species Pasteurella multocida [TaxId:747] [187521] (2 PDB entries)
  8. 2518374Domain d3s44a_: 3s44 A: [193582]
    automated match to d2ii6a_
    complexed with fn5; mutant

Details for d3s44a_

PDB Entry: 3s44 (more details), 1.45 Å

PDB Description: crystal structure of pasteurella multocida sialyltransferase m144d mutant with cmp bound
PDB Compounds: (A:) alpha-2,3/2,6-sialyltransferase/sialidase

SCOPe Domain Sequences for d3s44a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s44a_ c.87.1.9 (A:) automated matches {Pasteurella multocida [TaxId: 747]}
mktitlyldpaslpalnqlmdftqnnedkthprifglsrfkipdniitqyqnihfvelkd
nrptealftildqypgnielnihlniahsvqlirpilayrfkhldrvsiqqlnlyddgsd
eyvdlekeenkdisaeikqaekqlshylltgkikfdnptiaryvwqsafpvkyhflstdy
fekaeflqplkeylaenyqkmdwtayqqltpeqqafyltlvgfndevkqslevqqakfif
tgtttwegntdvreyyaqqqlnllnhftqaegdlfigdhykiyfkghprggeindyilnn
aknitnipanisfevlmmtgllpdkvggvasslyfslpkekishiiftsnkqvkskedal
nnpyvkvmrrlgiidesqvifwdslkql

SCOPe Domain Coordinates for d3s44a_:

Click to download the PDB-style file with coordinates for d3s44a_.
(The format of our PDB-style files is described here.)

Timeline for d3s44a_: