Lineage for d4fuba_ (4fub A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319884Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 1319885Species Human (Homo sapiens) [TaxId:9606] [50587] (63 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 1319899Domain d4fuba_: 4fub A: [193570]
    automated match to d3mwiu_
    complexed with 15p, 4up, act, gol, sin, so4

Details for d4fuba_

PDB Entry: 4fub (more details), 1.9 Å

PDB Description: crystal structure of the urokinase
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d4fuba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fuba_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtk

SCOPe Domain Coordinates for d4fuba_:

Click to download the PDB-style file with coordinates for d4fuba_.
(The format of our PDB-style files is described here.)

Timeline for d4fuba_: