| Class b: All beta proteins [48724] (174 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
| Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50587] (63 PDB entries) Uniprot P00749 156-178,179-424 |
| Domain d4fuba_: 4fub A: [193570] automated match to d3mwiu_ complexed with 15p, 4up, act, gol, sin, so4 |
PDB Entry: 4fub (more details), 1.9 Å
SCOPe Domain Sequences for d4fuba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fuba_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtk
Timeline for d4fuba_: