Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily) alpha+beta fold |
Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families) |
Family d.124.1.0: automated matches [193564] (1 protein) not a true family |
Protein automated matches [193565] (1 species) not a true protein |
Species Aspergillus niger [TaxId:5061] [193566] (2 PDB entries) |
Domain d3tbja_: 3tbj A: [193567] automated match to d1bola_ complexed with edo, nag, po4 |
PDB Entry: 3tbj (more details), 1.8 Å
SCOPe Domain Sequences for d3tbja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tbja_ d.124.1.0 (A:) automated matches {Aspergillus niger [TaxId: 5061]} tidtcssdsplscqtdneasccfnspggsllqtqfwdydpsdgpsdswtihglwpdncdg tyqeycdesreysnitsileaqnrtellsymkeywpdyegadedesfwehewnkhgtcin tiepscytdyyaqeevgdffqqvvdlfktldsytalsdagitpsedatyklsdiedalaa ihdgyppyvgcedgalsqlyyyfnvkgsaiggtyvaserledsnckdsgikyppkys
Timeline for d3tbja_: