Lineage for d3tbja_ (3tbj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974241Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 2974242Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families) (S)
  5. 2974284Family d.124.1.0: automated matches [193564] (1 protein)
    not a true family
  6. 2974285Protein automated matches [193565] (1 species)
    not a true protein
  7. 2974286Species Aspergillus niger [TaxId:5061] [193566] (2 PDB entries)
  8. 2974288Domain d3tbja_: 3tbj A: [193567]
    automated match to d1bola_
    complexed with edo, nag, po4

Details for d3tbja_

PDB Entry: 3tbj (more details), 1.8 Å

PDB Description: the 1.7a crystal structure of actibind a t2 ribonucleases as antitumorigenic agents
PDB Compounds: (A:) Actibind

SCOPe Domain Sequences for d3tbja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tbja_ d.124.1.0 (A:) automated matches {Aspergillus niger [TaxId: 5061]}
tidtcssdsplscqtdneasccfnspggsllqtqfwdydpsdgpsdswtihglwpdncdg
tyqeycdesreysnitsileaqnrtellsymkeywpdyegadedesfwehewnkhgtcin
tiepscytdyyaqeevgdffqqvvdlfktldsytalsdagitpsedatyklsdiedalaa
ihdgyppyvgcedgalsqlyyyfnvkgsaiggtyvaserledsnckdsgikyppkys

SCOPe Domain Coordinates for d3tbja_:

Click to download the PDB-style file with coordinates for d3tbja_.
(The format of our PDB-style files is described here.)

Timeline for d3tbja_: