SCOPe 2.02: Domain d2qlua_: 2qlu A:

Lineage for d2qlua_ (2qlu A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (7 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [192744] (16 PDB entries)

8. Domain d2qlua_: 2qlu A: [193554]
   automated match to d2wota_
   complexed with ade, so4

Details for d2qlua_

PDB Entry: 2qlu, 2 Å

PDB Description: Crystal structure of Activin receptor type II kinase domain from human

PDB Compounds: (A:) Activin receptor type IIB

SCOPe Domain Sequences for d2qlua_:

Sequence; same for both SEQRES and ATOM records:

>d2qlua_ d.144.1.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
gslqlleikargrfgcvwkaqlmndfvavkifplqdkqswqsereifstpgmkhenllqf
iaaekrgsnlevelwlitafhdkgsltdylkgniitwnelchvaetmsrglsylhedvpw
crgeghkpsiahrdfksknvllksdltavladfglavrfepgkppgdthgqvgtrrymap
evlegainfqrdaflridmyamglvlwelvsrckaadgpvdeymlpfeeeigqhpsleel
qevvvhkkmrptikdhwlkhpglaqlcvtieecwdhdaearlsagcveervslirrs

Timeline for d2qlua_:

• d2qlua_ is new in SCOPe 2.02-stable
  
• d2qlua_ appears in SCOPe 2.03
  
• d2qlua_ appears in the current release, SCOPe 2.08, called d2qlua1