SCOPe 2.08: Domain d2qlua1: 2qlu A:190-484

Lineage for d2qlua1 (2qlu A:190-484)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)

8. Domain d2qlua1: 2qlu A:190-484 [193554]
   Other proteins in same PDB: d2qlua2
   automated match to d2wota_
   complexed with ade, so4

Details for d2qlua1

PDB Entry: 2qlu, 2 Å

PDB Description: Crystal structure of Activin receptor type II kinase domain from human

PDB Compounds: (A:) Activin receptor type IIB

SCOPe Domain Sequences for d2qlua1:

Sequence; same for both SEQRES and ATOM records:

>d2qlua1 d.144.1.0 (A:190-484) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqlleikargrfgcvwkaqlmndfvavkifplqdkqswqsereifstpgmkhenllqfia
aekrgsnlevelwlitafhdkgsltdylkgniitwnelchvaetmsrglsylhedvpwcr
geghkpsiahrdfksknvllksdltavladfglavrfepgkppgdthgqvgtrrymapev
legainfqrdaflridmyamglvlwelvsrckaadgpvdeymlpfeeeigqhpsleelqe
vvvhkkmrptikdhwlkhpglaqlcvtieecwdhdaearlsagcveervslirrs

Timeline for d2qlua1:

• d2qlua1 first appeared in SCOPe 2.02, called d2qlua_
  
• d2qlua1 appears in SCOPe 2.07