SCOPe 2.04: Domain d4epba_: 4epb A:

Lineage for d4epba_ (4epb A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
   automatically mapped to Pfam PF00547

6. Protein Urease, gamma-subunit [54113] (4 species)

7. Species Enterobacter aerogenes [TaxId:548] [193552] (4 PDB entries)

8. Domain d4epba_: 4epb A: [193553]
   Other proteins in same PDB: d4epbb_, d4epbc1, d4epbc2
   automated match to d1ejxa_
   complexed with ni

Details for d4epba_

PDB Entry: 4epb, 1.75 Å

PDB Description: Final Urease Structure for Radiation Damage Experiment at 100 K

PDB Compounds: (A:) Urease subunit gamma

SCOPe Domain Sequences for d4epba_:

Sequence; same for both SEQRES and ATOM records:

>d4epba_ d.8.1.1 (A:) Urease, gamma-subunit {Enterobacter aerogenes [TaxId: 548]}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

Timeline for d4epba_:

• d4epba_ first appeared in SCOPe 2.02
  
• d4epba_ appears in SCOPe 2.03
  
• d4epba_ appears in SCOPe 2.05
  
• d4epba_ appears in the current release, SCOPe 2.08