Lineage for d4fa8g1 (4fa8 G:4-148)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705721Protein automated matches [190501] (4 species)
    not a true protein
  7. 2705722Species Human (Homo sapiens) [TaxId:9606] [187448] (21 PDB entries)
  8. 2705744Domain d4fa8g1: 4fa8 G:4-148 [193551]
    Other proteins in same PDB: d4fa8e2, d4fa8f2, d4fa8g2
    automated match to d1hmca_
    complexed with nag

Details for d4fa8g1

PDB Entry: 4fa8 (more details), 2.2 Å

PDB Description: multi-pronged modulation of cytokine signaling
PDB Compounds: (G:) macrophage colony-stimulating factor 1

SCOPe Domain Sequences for d4fa8g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fa8g1 a.26.1.2 (G:4-148) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimed
tmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvfne
tknlldkdwnifskncnnsfaecss

SCOPe Domain Coordinates for d4fa8g1:

Click to download the PDB-style file with coordinates for d4fa8g1.
(The format of our PDB-style files is described here.)

Timeline for d4fa8g1: