SCOPe 2.03: Domain d4fa8e_: 4fa8 E:

Lineage for d4fa8e_ (4fa8 E:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187448] (11 PDB entries)

8. Domain d4fa8e_: 4fa8 E: [193550]
   automated match to d1hmca_
   complexed with nag

Details for d4fa8e_

PDB Entry: 4fa8, 2.2 Å

PDB Description: multi-pronged modulation of cytokine signaling

PDB Compounds: (E:) macrophage colony-stimulating factor 1

SCOPe Domain Sequences for d4fa8e_:

Sequence; same for both SEQRES and ATOM records:

>d4fa8e_ a.26.1.2 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdim
edtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvf
netknlldkdwnifskncnnsfaec

Timeline for d4fa8e_:

• d4fa8e_ first appeared in SCOPe 2.02
  
• d4fa8e_ appears in SCOPe 2.04
  
• d4fa8e_ appears in the current release, SCOPe 2.08, called d4fa8e1