Lineage for d4fa8e_ (4fa8 E:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1085916Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1085917Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1085997Family a.26.1.2: Short-chain cytokines [47286] (14 protein domains)
  6. 1086124Protein automated matches [190501] (2 species)
    not a true protein
  7. 1086125Species Human (Homo sapiens) [TaxId:9606] [187448] (11 PDB entries)
  8. 1086132Domain d4fa8e_: 4fa8 E: [193550]
    automated match to d1hmca_
    complexed with nag

Details for d4fa8e_

PDB Entry: 4fa8 (more details), 2.2 Å

PDB Description: Multi-pronged modulation of cytokine signaling
PDB Compounds: (E:) macrophage colony-stimulating factor 1

SCOPe Domain Sequences for d4fa8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fa8e_ a.26.1.2 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdim
edtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvf
netknlldkdwnifskncnnsfaec

SCOPe Domain Coordinates for d4fa8e_:

Click to download the PDB-style file with coordinates for d4fa8e_.
(The format of our PDB-style files is described here.)

Timeline for d4fa8e_:

  • d4fa8e_ appears in periodic updates to SCOPe 2.02 starting on 2013-05-24
  • d4fa8e_ appears in SCOPe 2.03
  • d4fa8e_ appears in the current release, SCOPe 2.07, called d4fa8e1