| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
| Protein automated matches [190501] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187448] (21 PDB entries) |
| Domain d4fa8e1: 4fa8 E:4-146 [193550] Other proteins in same PDB: d4fa8e2, d4fa8f2, d4fa8g2 automated match to d1hmca_ complexed with nag |
PDB Entry: 4fa8 (more details), 2.2 Å
SCOPe Domain Sequences for d4fa8e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fa8e1 a.26.1.2 (E:4-146) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimed
tmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvfne
tknlldkdwnifskncnnsfaec
Timeline for d4fa8e1:
View in 3DDomains from other chains: (mouse over for more information) d4fa8f1, d4fa8f2, d4fa8g1, d4fa8g2 |