Lineage for d3v3xc_ (3v3x C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639448Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1639449Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1639474Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species)
  7. 1639478Species Streptococcus sp. [TaxId:1320] [193546] (2 PDB entries)
  8. 1639481Domain d3v3xc_: 3v3x C: [193547]
    automated match to d2qmta_
    complexed with 2pe, act, gol, mtn; mutant

Details for d3v3xc_

PDB Entry: 3v3x (more details), 2 Å

PDB Description: Nitroxide Spin Labels in Protein GB1: N8/K28 Double Mutant
PDB Compounds: (C:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d3v3xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v3xc_ d.15.7.1 (C:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]}
mqyklilcgktlkgettteavdaataecvfkqyandngvdgewtyddatktftvte

SCOPe Domain Coordinates for d3v3xc_:

Click to download the PDB-style file with coordinates for d3v3xc_.
(The format of our PDB-style files is described here.)

Timeline for d3v3xc_: